PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00651.1.g00300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 388aa    MW: 42626.3 Da    PI: 6.0869
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00651.1.g00300.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.62.3e-0768111542
                      zf-B_box   5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                   +C+ +e+ ++ l C+ +   lC+ C  + H+       H++vp+
  Zmw_sc00651.1.g00300.1.sm.mk  68 ICEACERLPAVLACRADAASLCAICDAQVHSAnplagrHQRVPV 111
                                   7*****************************66999999999986 PP

2CCT63.85.1e-22318361144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea++ RY+eK+k+RkF+K+irY++RK++Ae RpR+KGrF+k++
  Zmw_sc00651.1.g00300.1.sm.mk 318 REARVHRYREKKKNRKFKKTIRYATRKTYAEARPRIKGRFAKRS 361
                                   9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.6E-42168IPR000315B-box-type zinc finger
CDDcd000216.50E-62468No hitNo description
PROSITE profilePS501198.7452668IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3164111IPR000315B-box-type zinc finger
CDDcd000213.85E-868111No hitNo description
PfamPF006431.3E-568111IPR000315B-box-type zinc finger
SMARTSM003362.6E-869111IPR000315B-box-type zinc finger
PfamPF062031.1E-16318360IPR010402CCT domain
PROSITE profilePS5101716.311318360IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MNYNSSGDVF EQEGGGGESC PWARPCYGCH AAPSVVYCHA DVAYLCASCD TRVHAANRVA  60
SRHERVCICE ACERLPAVLA CRADAASLCA ICDAQVHSAN PLAGRHQRVP VLPLPAAAIP  120
AASVLAEVAA ASTALAEKEE EVDSWLLLGK NSNNSNCNTN NKKNLNNSGG SNMYFAEVDE  180
YFDLVGYNSY CDNHINNSPE QYGIQEQQEQ QQQQLVQKEF EDNEGSEFVV PSQVAMANKQ  240
QQNYYGGAEH AASVTAGVST YTDSISNSIS FSSMEVGIVP DNMAMDMTSH SILTPTGVNN  300
LFSGSSLQMP LHFSSMEREA RVHRYREKKK NRKFKKTIRY ATRKTYAEAR PRIKGRFAKR  360
SDMEEEADQM FSTAALSDGS YGAHFRNF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436860.11e-173hypothetical protein SORBIDRAFT_10g010050
SwissprotQ9FDX81e-119HD1_ORYSJ; Zinc finger protein HD1
TrEMBLM4ZUU11e-176M4ZUU1_SETIT; Heading date 1
STRINGSb10g010050.11e-173(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56223140